Lineage for d6nwsa1 (6nws A:265-507)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343151Domain d6nwsa1: 6nws A:265-507 [370934]
    Other proteins in same PDB: d6nwsa2
    automated match to d1xdkb_
    complexed with l77

Details for d6nwsa1

PDB Entry: 6nws (more details), 2.44 Å

PDB Description: rorgamma ligand binding domain
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6nwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nwsa1 a.123.1.0 (A:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs

SCOPe Domain Coordinates for d6nwsa1:

Click to download the PDB-style file with coordinates for d6nwsa1.
(The format of our PDB-style files is described here.)

Timeline for d6nwsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nwsa2