Lineage for d1dkid_ (1dki D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497141Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2497480Protein Streptococcal pyrogenic exotoxin B [54035] (1 species)
  7. 2497481Species Streptococcus pyogenes [TaxId:1314] [54036] (2 PDB entries)
    Uniprot P00788 31-398
  8. 2497485Domain d1dkid_: 1dki D: [37093]
    zymogen
    complexed with so4; mutant

Details for d1dkid_

PDB Entry: 1dki (more details), 1.6 Å

PDB Description: crystal structure of the zymogen form of streptococcal pyrogenic exotoxin b active site (c47s) mutant
PDB Compounds: (D:) pyrogenic exotoxin b zymogen

SCOPe Domain Sequences for d1dkid_:

Sequence, based on SEQRES records: (download)

>d1dkid_ d.3.1.1 (D:) Streptococcal pyrogenic exotoxin B {Streptococcus pyogenes [TaxId: 1314]}
farnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistggfvi
vsgdkrspeilgystsgsfdvngkeniasfmesyveqikenkkldstyagtaeikqpvvk
slldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataqimkyhnypnkg
lkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmadvgi
svdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvy
yqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggaggfngyq
savvgikp

Sequence, based on observed residues (ATOM records): (download)

>d1dkid_ d.3.1.1 (D:) Streptococcal pyrogenic exotoxin B {Streptococcus pyogenes [TaxId: 1314]}
farnekeakdsaitfiqkldkvnlggelsgsnmyvynistggfvivsgdkrspeilgyst
sgsfdvngkeniasfmesyveqikenkkldstyagqpvvkslldskgihynqgnpynllt
pviekvkpgeqsfvgqhaatgsvatataqimkyhnypnkglkdytytlssnnpyfnhpkn
lfaaistrqynwnnilptysgresnvqkmaiselmadvgisvdmdygpssgsagssrvqr
alkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvyyqgvgkvgghafvidgadgr
nfyhvnwgwggvsdgffrldalnpyqsavvgikp

SCOPe Domain Coordinates for d1dkid_:

Click to download the PDB-style file with coordinates for d1dkid_.
(The format of our PDB-style files is described here.)

Timeline for d1dkid_: