SCOPe 2.08: Domain d6nqjb1: 6nqj B:3-221

Lineage for d6nqjb1 (6nqj B:3-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)

8. Domain d6nqjb1: 6nqj B:3-221 [370914]
   Other proteins in same PDB: d6nqja2, d6nqjb2, d6nqjc2, d6nqjc3
   automated match to d3srya_
   mutant

Details for d6nqjb1

PDB Entry: 6nqj, 2 Å

PDB Description: crystal structure of fast switching m159t mutant of fluorescent protein dronpa (dronpa2)

PDB Compounds: (B:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d6nqjb1:

Sequence; same for both SEQRES and ATOM records:

>d6nqjb1 d.22.1.0 (B:3-221) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahsglpr

Timeline for d6nqjb1:

• d6nqjb1 first appeared in SCOPe 2.07