SCOPe 2.08: Domain d6nucb1: 6nuc B:16-170

Lineage for d6nucb1 (6nuc B:16-170)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries)

8. Domain d6nucb1: 6nuc B:16-170 [370907]
   Other proteins in same PDB: d6nuca_, d6nucb2
   automated match to d1m63b_
   complexed with ca, fe, na, peg, po4, zn

Details for d6nucb1

PDB Entry: 6nuc, 1.9 Å

PDB Description: structure of calcineurin in complex with nhe1 peptide

PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d6nucb1:

Sequence; same for both SEQRES and ATOM records:

>d6nucb1 a.39.1.5 (B:16-170) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
tiinadkdgdgrisfeefcavvggldihkkmvvdv

Timeline for d6nucb1:

• d6nucb1 first appeared in SCOPe 2.07