Lineage for d1ef7b_ (1ef7 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29568Family d.3.1.1: Papain-like [54002] (15 proteins)
  6. 29614Protein (Pro)cathepsin X [54031] (1 species)
  7. 29615Species Human (Homo sapiens) [TaxId:9606] [54032] (2 PDB entries)
  8. 29619Domain d1ef7b_: 1ef7 B: [37088]

Details for d1ef7b_

PDB Entry: 1ef7 (more details), 2.67 Å

PDB Description: crystal structure of human cathepsin x

SCOP Domain Sequences for d1ef7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef7b_ d.3.1.1 (B:) (Pro)cathepsin X {Human (Homo sapiens)}
lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq
nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha
irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh
vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp
iv

SCOP Domain Coordinates for d1ef7b_:

Click to download the PDB-style file with coordinates for d1ef7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ef7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ef7a_