Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin X [54031] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54032] (2 PDB entries) |
Domain d1ef7a_: 1ef7 A: [37087] |
PDB Entry: 1ef7 (more details), 2.67 Å
SCOPe Domain Sequences for d1ef7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef7a_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp iv
Timeline for d1ef7a_: