Lineage for d1ef7a_ (1ef7 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889122Protein (Pro)cathepsin X [54031] (1 species)
  7. 1889123Species Human (Homo sapiens) [TaxId:9606] [54032] (2 PDB entries)
  8. 1889126Domain d1ef7a_: 1ef7 A: [37087]

Details for d1ef7a_

PDB Entry: 1ef7 (more details), 2.67 Å

PDB Description: crystal structure of human cathepsin x
PDB Compounds: (A:) cathepsin x

SCOPe Domain Sequences for d1ef7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef7a_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]}
lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq
nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha
irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh
vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp
iv

SCOPe Domain Coordinates for d1ef7a_:

Click to download the PDB-style file with coordinates for d1ef7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ef7b_