Lineage for d1ef7a_ (1ef7 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29568Family d.3.1.1: Papain-like [54002] (15 proteins)
  6. 29614Protein (Pro)cathepsin X [54031] (1 species)
  7. 29615Species Human (Homo sapiens) [TaxId:9606] [54032] (2 PDB entries)
  8. 29618Domain d1ef7a_: 1ef7 A: [37087]

Details for d1ef7a_

PDB Entry: 1ef7 (more details), 2.67 Å

PDB Description: crystal structure of human cathepsin x

SCOP Domain Sequences for d1ef7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef7a_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens)}
lpkswdwrnvdgvnyasitrnqhipqycgscwahastsamadrinikrkgawpstllsvq
nvidcgnagsceggndlsvwdyahqhgipdetcnnyqakdqecdkfnqcgtcnefkecha
irnytlwrvgdygslsgrekmmaeiyangpiscgimaterlanytggiyaeyqdttyinh
vvsvagwgisdgteywivrnswgepwgergwlrivtstykdgkgarynlaieehctfgdp
iv

SCOP Domain Coordinates for d1ef7a_:

Click to download the PDB-style file with coordinates for d1ef7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ef7b_