Lineage for d6nqsb1 (6nqs B:3-223)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940931Domain d6nqsb1: 6nqs B:3-223 [370826]
    Other proteins in same PDB: d6nqsa2, d6nqsb2, d6nqsg2, d6nqsh2
    automated match to d3srya_
    mutant

Details for d6nqsb1

PDB Entry: 6nqs (more details), 2.5 Å

PDB Description: crystal structure of fast switching m159t mutant of fluorescent protein dronpa (dronpa2)- y63(3-omey)
PDB Compounds: (B:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d6nqsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nqsb1 d.22.1.0 (B:3-223) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfx
nrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdgvn
fpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakkvvq
lpdyhfvdhhieikshdkdysnvnlhehaeahsglprqa

SCOPe Domain Coordinates for d6nqsb1:

Click to download the PDB-style file with coordinates for d6nqsb1.
(The format of our PDB-style files is described here.)

Timeline for d6nqsb1: