Lineage for d7pckd_ (7pck D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154605Protein (Pro)cathepsin K [54028] (3 species)
  7. 2154606Species Human (Homo sapiens) [TaxId:9606] [54029] (51 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2154657Domain d7pckd_: 7pck D: [37082]
    contains propeptide

Details for d7pckd_

PDB Entry: 7pck (more details), 3.2 Å

PDB Description: crystal structure of wild type human procathepsin k
PDB Compounds: (D:) protein (procathepsin k)

SCOPe Domain Sequences for d7pckd_:

Sequence, based on SEQRES records: (download)

>d7pckd_ d.3.1.1 (D:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam
nhlgdmtseevvqkmtglkvplshsrsndtlyipewegrapdsvdyrkkgyvtpvknqgq
cgscwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgi
dsedaypyvgqeescmynptgkaakcrgyreipegnekalkravarvgpvsvaidaslts
fqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnkn
nacgianlasfpkm

Sequence, based on observed residues (ATOM records): (download)

>d7pckd_ d.3.1.1 (D:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam
nhlgdmtseevvqkmtglkvlyiapdsvdyrkkgyvtpvknqgqcgscwafssvgalegq
lkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescm
ynptgkaakcrgyreipegnekalkravarvgpvsvaidasltsfqfyskgvyydescns
dnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d7pckd_:

Click to download the PDB-style file with coordinates for d7pckd_.
(The format of our PDB-style files is described here.)

Timeline for d7pckd_: