Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin K [54028] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
Domain d7pckb_: 7pck B: [37080] contains propeptide has additional insertions and/or extensions that are not grouped together |
PDB Entry: 7pck (more details), 3.2 Å
SCOPe Domain Sequences for d7pckb_:
Sequence, based on SEQRES records: (download)
>d7pckb_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam nhlgdmtseevvqkmtglkvplshsrsndtlyipewegrapdsvdyrkkgyvtpvknqgq cgscwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgi dsedaypyvgqeescmynptgkaakcrgyreipegnekalkravarvgpvsvaidaslts fqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnkn nacgianlasfpkm
>d7pckb_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam nhlgdmtseevvqkmtglkvplrsndtlyipewegrapdsvdyrkkgyvtpvknqgqcgs cwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgidse daypyvgqeescmynptgkaakcrgyreipegnekalkravarvgpvsvaidasltsfqf yskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnknnac gianlasfpkm
Timeline for d7pckb_: