![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (7 families) ![]() |
![]() | Family d.3.1.1: Papain-like [54002] (15 proteins) |
![]() | Protein (Pro)cathepsin K [54028] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54029] (12 PDB entries) |
![]() | Domain d7pcka_: 7pck A: [37079] |
PDB Entry: 7pck (more details), 3.2 Å
SCOP Domain Sequences for d7pcka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7pcka_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens)} lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam nhlgdmtseevvqkmtglkvplshsrsndtlyipewegrapdsvdyrkkgyvtpvknqgq cgscwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgi dsedaypyvgqeescmynptgkaakcrgyreipegnekalkravarvgpvsvaidaslts fqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnkn nacgianlasfpkm
Timeline for d7pcka_: