SCOPe 2.07: Domain d6nngb1: 6nng B:2-243

Lineage for d6nngb1 (6nng B:2-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d6nngb1: 6nng B:2-243 [370772]
   Other proteins in same PDB: d6nnga2, d6nngb2, d6nngc2, d6nngd2, d6nnge_, d6nngf1, d6nngf2, d6nngf3
   automated match to d4drxb1
   complexed with acp, ca, dj9, gdp, gtp, mes, mg

Details for d6nngb1

PDB Entry: 6nng, 2.4 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound dj95

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6nngb1:

Sequence; same for both SEQRES and ATOM records:

>d6nngb1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6nngb1:

• d6nngb1 is new in SCOPe 2.07-stable
  
• d6nngb1 appears in the current release, SCOPe 2.08