SCOPe 2.07: Domain d6nhgb2: 6nhg B:236-439

Lineage for d6nhgb2 (6nhg B:236-439)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
   Uniprot P23004

8. Domain d6nhgb2: 6nhg B:236-439 [370757]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntmb2
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgb2

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d6nhgb2:

Sequence; same for both SEQRES and ATOM records:

>d6nhgb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d6nhgb2:

• d6nhgb2 is new in SCOPe 2.07-stable
  
• d6nhgb2 appears in the current release, SCOPe 2.08