Lineage for d6n5db_ (6n5d B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386438Domain d6n5db_: 6n5d B: [370753]
    Other proteins in same PDB: d6n5dd1, d6n5dd2, d6n5df1, d6n5df2, d6n5dn1, d6n5dn2
    automated match to d3s13a_

Details for d6n5db_

PDB Entry: 6n5d (more details), 3 Å

PDB Description: broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6n5db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n5db_ b.19.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
tnatelvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsn
cypydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltk
sgstypvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipn
igsrpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidt
cisecitpngsipndkpfqnvnkitygacpkyvkqntlklat

SCOPe Domain Coordinates for d6n5db_:

Click to download the PDB-style file with coordinates for d6n5db_.
(The format of our PDB-style files is described here.)

Timeline for d6n5db_: