SCOPe 2.05: Domain d1bgoa_: 1bgo A:

Lineage for d1bgoa_ (1bgo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (45 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1bgoa_: 1bgo A: [37074]
   complexed with i10

Details for d1bgoa_

PDB Entry: 1bgo, 2.3 Å

PDB Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1bgoa_:

Sequence; same for both SEQRES and ATOM records:

>d1bgoa_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1bgoa_:

• d1bgoa_ first appeared (with stable ids) in SCOP 1.55, called d1bgo__
  
• d1bgoa_ appears in SCOPe 2.04
  
• d1bgoa_ appears in SCOPe 2.06
  
• d1bgoa_ appears in the current release, SCOPe 2.08