Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6n8de1: 6n8d E:1-106 [370730] Other proteins in same PDB: d6n8da_, d6n8db2, d6n8dc_, d6n8de2 automated match to d1dn0a1 |
PDB Entry: 6n8d (more details), 3.1 Å
SCOPe Domain Sequences for d6n8de1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n8de1 b.1.1.1 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkvei
Timeline for d6n8de1: