SCOP 1.73: Domain d1au3a_: 1au3 A:

Lineage for d1au3a_ (1au3 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (28 PDB entries)

8. Domain d1au3a_: 1au3 A: [37073]
   complexed with pcm

Details for d1au3a_

PDB Entry: 1au3, 2.5 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor

PDB Compounds: (A:) cathepsin k

SCOP Domain Sequences for d1au3a_:

Sequence; same for both SEQRES and ATOM records:

>d1au3a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1au3a_:

• d1au3a_ first appeared (with stable ids) in SCOP 1.55, called d1au3__
  
• d1au3a_ was called d1au3__ in SCOP 1.71
  
• d1au3a_ appears in SCOP 1.75
  
• d1au3a_ appears in the current release, SCOPe 2.08