Lineage for d1ayv__ (1ayv -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (16 proteins) 
Protein (Pro)cathepsin K [54028] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54029] (12 PDB entries) 
Domain d1ayv__: 1ayv - [37072]
Details for d1ayv__
PDB Entry: 1ayv (more details), 2.3 Å
PDB Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent thiazolhydrazide inhibitor
SCOP Domain Sequences for d1ayv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayv__ d.3.1.1 (-) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm
SCOP Domain Coordinates for d1ayv__:
Click to download the PDB-style file with coordinates for d1ayv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayv__:
- d1ayv__ first appeared (with stable ids) in SCOP 1.55
- d1ayv__ appears in SCOP 1.59
- d1ayv__ appears in the current release, SCOPe 2.08, called d1ayva_
View in 3D