Lineage for d1atk__ (1atk -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597011Family d.3.1.1: Papain-like [54002] (23 proteins)
  6. 597037Protein (Pro)cathepsin K [54028] (1 species)
  7. 597038Species Human (Homo sapiens) [TaxId:9606] [54029] (17 PDB entries)
  8. 597044Domain d1atk__: 1atk - [37071]
    complexed with e64

Details for d1atk__

PDB Entry: 1atk (more details), 2.2 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor e-64

SCOP Domain Sequences for d1atk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atk__ d.3.1.1 (-) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

SCOP Domain Coordinates for d1atk__:

Click to download the PDB-style file with coordinates for d1atk__.
(The format of our PDB-style files is described here.)

Timeline for d1atk__: