Lineage for d6n84a_ (6n84 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522155Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries)
  8. 2522188Domain d6n84a_: 6n84 A: [370696]
    automated match to d5e7ua_
    complexed with mal, so4

Details for d6n84a_

PDB Entry: 6n84 (more details), 1.75 Å

PDB Description: mbp-fusion protein of transducin-alpha residues 327-350
PDB Compounds: (A:) G alpha t C terminal fragment fused to maltose binding protein

SCOPe Domain Sequences for d6n84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n84a_ c.94.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtrithnvkfvfdavtdiiikenlkdcg

SCOPe Domain Coordinates for d6n84a_:

Click to download the PDB-style file with coordinates for d6n84a_.
(The format of our PDB-style files is described here.)

Timeline for d6n84a_: