Lineage for d1icf.2 (1icf C:,D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715178Family d.3.1.1: Papain-like [54002] (25 proteins)
  6. 715251Protein (Pro)cathepsin L [54026] (1 species)
  7. 715252Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)
  8. 715257Domain d1icf.2: 1icf C:,D: [37068]
    Other proteins in same PDB: d1icfi_, d1icfj_

Details for d1icf.2

PDB Entry: 1icf (more details), 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l
PDB Compounds: (C:) protein (cathepsin l: heavy chain), (D:) protein (cathepsin l: light chain)

SCOP Domain Sequences for d1icf.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1icf.2 d.3.1.1 (C:,D:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestXnnky
wlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOP Domain Coordinates for d1icf.2:

Click to download the PDB-style file with coordinates for d1icf.2.
(The format of our PDB-style files is described here.)

Timeline for d1icf.2: