Lineage for d1icf.2 (1icf C:,D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597011Family d.3.1.1: Papain-like [54002] (23 proteins)
  6. 597062Protein (Pro)cathepsin L [54026] (1 species)
  7. 597063Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)
  8. 597068Domain d1icf.2: 1icf C:,D: [37068]
    Other proteins in same PDB: d1icfi_, d1icfj_

Details for d1icf.2

PDB Entry: 1icf (more details), 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

SCOP Domain Sequences for d1icf.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1icf.2 d.3.1.1 (C:,D:) (Pro)cathepsin L {Human (Homo sapiens)}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestXnnky
wlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOP Domain Coordinates for d1icf.2:

Click to download the PDB-style file with coordinates for d1icf.2.
(The format of our PDB-style files is described here.)

Timeline for d1icf.2: