Lineage for d6mnnc1 (6mnn C:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938315Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries)
  8. 2938319Domain d6mnnc1: 6mnn C:0-81 [370669]
    Other proteins in same PDB: d6mnna1, d6mnna2, d6mnnb1, d6mnnb2, d6mnnc2
    automated match to d1iaka2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d6mnnc1

PDB Entry: 6mnn (more details), 2.83 Å

PDB Description: 6236 tcr bound to i-ab padi4
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mnnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnnc1 d.19.1.1 (C:0-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOPe Domain Coordinates for d6mnnc1:

Click to download the PDB-style file with coordinates for d6mnnc1.
(The format of our PDB-style files is described here.)

Timeline for d6mnnc1: