Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (23 proteins) |
Protein (Pro)cathepsin L [54026] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries) |
Domain d1cjl__: 1cjl - [37066] contains propeptide mutant |
PDB Entry: 1cjl (more details), 2.2 Å
SCOP Domain Sequences for d1cjl__:
Sequence, based on SEQRES records: (download)
>d1cjl__ d.3.1.1 (-) (Pro)cathepsin L {Human (Homo sapiens)} dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke giyfepdcssedmdhgvlvvgygfestesdgnkywlvknswgeewgmggyvkmakdrrnh cgiasaasyptv
>d1cjl__ d.3.1.1 (-) (Pro)cathepsin L {Human (Homo sapiens)} dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke giyfepdcssedmdhgvlvvgygfesnkywlvknswgeewgmggyvkmakdrrnhcgias aasyptv
Timeline for d1cjl__: