Lineage for d1cjl__ (1cjl -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29568Family d.3.1.1: Papain-like [54002] (15 proteins)
  6. 29608Protein (Pro)cathepsin L [54026] (1 species)
  7. 29609Species Human (Homo sapiens) [TaxId:9606] [54027] (3 PDB entries)
  8. 29611Domain d1cjl__: 1cjl - [37066]

Details for d1cjl__

PDB Entry: 1cjl (more details), 2.2 Å

PDB Description: crystal structure of a cysteine protease proform

SCOP Domain Sequences for d1cjl__:

Sequence, based on SEQRES records: (download)

>d1cjl__ d.3.1.1 (-) (Pro)cathepsin L {Human (Homo sapiens)}
dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
giyfepdcssedmdhgvlvvgygfestesdgnkywlvknswgeewgmggyvkmakdrrnh
cgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d1cjl__ d.3.1.1 (-) (Pro)cathepsin L {Human (Homo sapiens)}
dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
giyfepdcssedmdhgvlvvgygfesnkywlvknswgeewgmggyvkmakdrrnhcgias
aasyptv

SCOP Domain Coordinates for d1cjl__:

Click to download the PDB-style file with coordinates for d1cjl__.
(The format of our PDB-style files is described here.)

Timeline for d1cjl__: