Lineage for d1cjla_ (1cjl A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154664Protein (Pro)cathepsin L [54026] (1 species)
  7. 2154665Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)
  8. 2154669Domain d1cjla_: 1cjl A: [37066]
    contains propeptide

Details for d1cjla_

PDB Entry: 1cjl (more details), 2.2 Å

PDB Description: crystal structure of a cysteine protease proform
PDB Compounds: (A:) procathepsin l

SCOPe Domain Sequences for d1cjla_:

Sequence, based on SEQRES records: (download)

>d1cjla_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
giyfepdcssedmdhgvlvvgygfestesdgnkywlvknswgeewgmggyvkmakdrrnh
cgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d1cjla_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
dhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmamnafg
dmtseefrqvmnglqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgsswaf
satgalegqmfrktgrlislseqnlvdcsgpegnegcngglmdyafqyvqdnggldsees
ypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesflfyke
giyfepdcssedmdhgvlvvgygfesnkywlvknswgeewgmggyvkmakdrrnhcgias
aasyptv

SCOPe Domain Coordinates for d1cjla_:

Click to download the PDB-style file with coordinates for d1cjla_.
(The format of our PDB-style files is described here.)

Timeline for d1cjla_: