Lineage for d6mnga2 (6mng A:116-203)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (610 PDB entries)
  8. 3070593Domain d6mnga2: 6mng A:116-203 [370655]
    Other proteins in same PDB: d6mnga1, d6mngb1, d6mngc1, d6mngc2
    automated match to d2f54d2

Details for d6mnga2

PDB Entry: 6mng (more details), 2.66 Å

PDB Description: 4738 tcr bound to iab padi4
PDB Compounds: (A:) 4738 TCR alpha chain

SCOPe Domain Sequences for d6mnga2:

Sequence, based on SEQRES records: (download)

>d6mnga2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d6mnga2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d6mnga2:

Click to download the PDB-style file with coordinates for d6mnga2.
(The format of our PDB-style files is described here.)

Timeline for d6mnga2:

  • d6mnga2 is new in SCOPe 2.07-stable