Lineage for d6mnga1 (6mng A:3-115)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (27 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (738 PDB entries)
  8. 3070592Domain d6mnga1: 6mng A:3-115 [370654]
    Other proteins in same PDB: d6mnga2, d6mngb2, d6mngc1, d6mngc2
    automated match to d2f54d1

Details for d6mnga1

PDB Entry: 6mng (more details), 2.66 Å

PDB Description: 4738 tcr bound to iab padi4
PDB Compounds: (A:) 4738 TCR alpha chain

SCOPe Domain Sequences for d6mnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnga1 b.1.1.0 (A:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvrqspqsltvwegetailncsyensafdylpwyqqfpgegpalliairsvsdkkedgrf
tiffnkrekklslhitdsqpgdsatyfcagidtgantgkltfghgtilrvhpn

SCOPe Domain Coordinates for d6mnga1:

Click to download the PDB-style file with coordinates for d6mnga1.
(The format of our PDB-style files is described here.)

Timeline for d6mnga1:

  • d6mnga1 is new in SCOPe 2.07-stable