Lineage for d6n10a2 (6n10 A:199-412)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521481Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2521562Family d.58.26.0: automated matches [227186] (1 protein)
    not a true family
  6. 2521563Protein automated matches [226908] (4 species)
    not a true protein
  7. 3070587Species Arabidopsis thaliana [TaxId:3702] [370649] (1 PDB entry)
  8. 3070588Domain d6n10a2: 6n10 A:199-412 [370650]
    Other proteins in same PDB: d6n10a1
    automated match to d3d4ja2
    complexed with dp6, so4

Details for d6n10a2

PDB Entry: 6n10 (more details), 2.3 Å

PDB Description: crystal structure of arabidopsis thaliana mevalonate 5-diphosphate decarboxylase 1 complexed with (r)-mvapp
PDB Compounds: (A:) Diphosphomevalonate decarboxylase MVD1, peroxisomal

SCOPe Domain Sequences for d6n10a2:

Sequence, based on SEQRES records: (download)

>d6n10a2 d.58.26.0 (A:199-412) automated matches {Arabidopsis thaliana [TaxId: 3702]}
dlviiiavvssrqketsstsgmresvetslllqhrakevvpvrilqmeeaiknrdftsft
kltcsdsnqfhavcmdtsppifymndtshriislvekwnrsagtpeiaytfdagpnavmi
arnrkvavellqgllycfppkpdtdmksyvlgdtsivkeaglegelpqgikdkigsqdqk
gevsyficsrpgrgpvvlqdqtqallhpqtglpk

Sequence, based on observed residues (ATOM records): (download)

>d6n10a2 d.58.26.0 (A:199-412) automated matches {Arabidopsis thaliana [TaxId: 3702]}
dlviiiavvssrqketsstsgmresvetslllqhrakevvpvrilqmeeaiknrdftsft
kltcsdsnqfhavcmdtsppifymndtshriislvekwnrsagtpeiaytfdagpnavmi
arnrkvavellqgllycfppkpdtdmksyvlgdtsivkepqgikdkigsqdqkgevsyfi
csrpgrgpvvlqdqtqallhpqtglpk

SCOPe Domain Coordinates for d6n10a2:

Click to download the PDB-style file with coordinates for d6n10a2.
(The format of our PDB-style files is described here.)

Timeline for d6n10a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6n10a1