Lineage for d1cs8a_ (1cs8 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1191815Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1191892Protein (Pro)cathepsin L [54026] (1 species)
  7. 1191893Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)
  8. 1191894Domain d1cs8a_: 1cs8 A: [37065]
    contains propeptide

Details for d1cs8a_

PDB Entry: 1cs8 (more details), 1.8 Å

PDB Description: crystal structure of procathepsin l
PDB Compounds: (A:) human procathepsin l

SCOPe Domain Sequences for d1cs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
sltfdhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmam
nafgdmtseefrqvmngfqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgs
cwafsatgalegqmfrktgrlislseqnlvdcsgpqgnegcngglmdyafqyvqdnggld
seesypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesfl
fykegiyfepdcssedmdhgvlvvgygfestesdnnkywlvknswgeewgmggyvkmakd
rrnhcgiasaasyptv

SCOPe Domain Coordinates for d1cs8a_:

Click to download the PDB-style file with coordinates for d1cs8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cs8a_: