![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (12 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (23 proteins) |
![]() | Protein (Pro)cathepsin L [54026] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries) |
![]() | Domain d1cs8a_: 1cs8 A: [37065] contains propeptide mutant |
PDB Entry: 1cs8 (more details), 1.8 Å
SCOP Domain Sequences for d1cs8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens)} sltfdhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmam nafgdmtseefrqvmngfqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgs cwafsatgalegqmfrktgrlislseqnlvdcsgpqgnegcngglmdyafqyvqdnggld seesypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesfl fykegiyfepdcssedmdhgvlvvgygfestesdnnkywlvknswgeewgmggyvkmakd rrnhcgiasaasyptv
Timeline for d1cs8a_: