Lineage for d6n10a1 (6n10 A:3-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931148Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)
  8. 2931165Domain d6n10a1: 6n10 A:3-198 [370648]
    Other proteins in same PDB: d6n10a2
    automated match to d3d4ja1
    complexed with dp6, so4

Details for d6n10a1

PDB Entry: 6n10 (more details), 2.3 Å

PDB Description: crystal structure of arabidopsis thaliana mevalonate 5-diphosphate decarboxylase 1 complexed with (r)-mvapp
PDB Compounds: (A:) Diphosphomevalonate decarboxylase MVD1, peroxisomal

SCOPe Domain Sequences for d6n10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n10a1 d.14.1.0 (A:3-198) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eekwvvmvtaqtptniavikywgkrdevrilpindsisvtldpdhlctlttvavspsfdr
drmwlngkeislsgsryqnclreirsraddvedkekgikiakkdweklhlhiashnnfpt
aaglassaagfaclvfalaklmnvnedpsqlsaiarqgsgsacrslfggfvkwnmgnked
gsdsvavqlvddkhwd

SCOPe Domain Coordinates for d6n10a1:

Click to download the PDB-style file with coordinates for d6n10a1.
(The format of our PDB-style files is described here.)

Timeline for d6n10a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6n10a2