Lineage for d1qdqa_ (1qdq A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154580Protein (Pro)cathepsin B [54022] (3 species)
  7. 2154581Species Cow (Bos taurus) [TaxId:9913] [54025] (3 PDB entries)
  8. 2154582Domain d1qdqa_: 1qdq A: [37064]
    complexed with 074

Details for d1qdqa_

PDB Entry: 1qdq (more details), 2.18 Å

PDB Description: x-ray crystal structure of bovine cathepsin b-ca074 complex
PDB Compounds: (A:) cathepsin b

SCOPe Domain Sequences for d1qdqa_:

Sequence, based on SEQRES records: (download)

>d1qdqa_ d.3.1.1 (A:) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]}
lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsngrvnvevsaedml
tccggecgdgcnggepsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppct
gegdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdf
llyksgvyqhvsgeimgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhc
gieseivagmpct

Sequence, based on observed residues (ATOM records): (download)

>d1qdqa_ d.3.1.1 (A:) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]}
lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsnvnvevsaedmltc
cggecgdgcnggepsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppctge
gdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdfll
yksgvyqhvsgeimgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcgi
eseivagmpct

SCOPe Domain Coordinates for d1qdqa_:

Click to download the PDB-style file with coordinates for d1qdqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qdqa_: