SCOPe 2.07: Domain d6mnoa1: 6mno A:2-115

Lineage for d6mnoa1 (6mno A:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6mnoa1: 6mno A:2-115 [370637]
   Other proteins in same PDB: d6mnoa2, d6mnob2, d6mnoc1, d6mnoc2
   automated match to d2f54d1

Details for d6mnoa1

PDB Entry: 6mno, 2.9 Å

PDB Description: 6235 tcr bound to i-ab padi4

PDB Compounds: (A:) 6235 TCR alpha chain

SCOPe Domain Sequences for d6mnoa1:

Sequence; same for both SEQRES and ATOM records:

>d6mnoa1 b.1.1.0 (A:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpalliairsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaasetgantgkltfghgtilrvhpn

Timeline for d6mnoa1:

• d6mnoa1 is new in SCOPe 2.07-stable
  
• d6mnoa1 appears in the current release, SCOPe 2.08