| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
| Domain d6mnoa1: 6mno A:2-115 [370637] Other proteins in same PDB: d6mnoa2, d6mnob2, d6mnoc1, d6mnoc2 automated match to d2f54d1 |
PDB Entry: 6mno (more details), 2.9 Å
SCOPe Domain Sequences for d6mnoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mnoa1 b.1.1.0 (A:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpalliairsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaasetgantgkltfghgtilrvhpn
Timeline for d6mnoa1:
View in 3DDomains from other chains: (mouse over for more information) d6mnob1, d6mnob2, d6mnoc1, d6mnoc2 |