Lineage for d6mngb1 (6mng B:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761053Domain d6mngb1: 6mng B:1-111 [370630]
    Other proteins in same PDB: d6mnga2, d6mngb2, d6mngc1, d6mngc2
    automated match to d3rugf1

Details for d6mngb1

PDB Entry: 6mng (more details), 2.66 Å

PDB Description: 4738 tcr bound to iab padi4
PDB Compounds: (B:) 4738 TCR beta chain

SCOPe Domain Sequences for d6mngb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mngb1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle

SCOPe Domain Coordinates for d6mngb1:

Click to download the PDB-style file with coordinates for d6mngb1.
(The format of our PDB-style files is described here.)

Timeline for d6mngb1: