Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d6mnna2: 6mnn A:116-203 [370621] Other proteins in same PDB: d6mnna1, d6mnnb1, d6mnnc1, d6mnnc2 automated match to d2f54d2 |
PDB Entry: 6mnn (more details), 2.83 Å
SCOPe Domain Sequences for d6mnna2:
Sequence, based on SEQRES records: (download)
>d6mnna2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d6mnna2 b.1.1.2 (A:116-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw sndfacanafnnsiipedtffp
Timeline for d6mnna2:
View in 3D Domains from other chains: (mouse over for more information) d6mnnb1, d6mnnb2, d6mnnc1, d6mnnc2 |