Lineage for d6mnna1 (6mnn A:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761140Domain d6mnna1: 6mnn A:2-115 [370620]
    Other proteins in same PDB: d6mnna2, d6mnnb2, d6mnnc1, d6mnnc2
    automated match to d2f54d1

Details for d6mnna1

PDB Entry: 6mnn (more details), 2.83 Å

PDB Description: 6236 tcr bound to i-ab padi4
PDB Compounds: (A:) 6236 TCR alpha chain

SCOPe Domain Sequences for d6mnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnna1 b.1.1.0 (A:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpalliairsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaasvtgantgkltfghgtilrvhpn

SCOPe Domain Coordinates for d6mnna1:

Click to download the PDB-style file with coordinates for d6mnna1.
(The format of our PDB-style files is described here.)

Timeline for d6mnna1: