SCOPe 2.05: Domain d1mira_: 1mir A:

Lineage for d1mira_ (1mir A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin B [54022] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54024] (4 PDB entries)

8. Domain d1mira_: 1mir A: [37062]
   zymogen

Details for d1mira_

PDB Entry: 1mir, 2.8 Å

PDB Description: rat procathepsin b

PDB Compounds: (A:) procathepsin b

SCOPe Domain Sequences for d1mira_:

Sequence; same for both SEQRES and ATOM records:

>d1mira_ d.3.1.1 (A:) (Pro)cathepsin B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sddminyinkqnttwqagrnfynvdisylkklcgtvlggpklpervgfsedinlpesfda
reqwsncptiaqirdqgscgsswafgaveamsdricihtngrvnvevsaedlltccgiqc
gdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppctgegdtpk
cnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdfltyksgv
ykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhcgieseiv
agiprtqqywgrf

Timeline for d1mira_:

• d1mira_ first appeared (with stable ids) in SCOP 1.55
  
• d1mira_ appears in SCOPe 2.04
  
• d1mira_ appears in SCOPe 2.06
  
• d1mira_ appears in the current release, SCOPe 2.08