SCOPe 2.08: Domain d6macc_: 6mac C:

Lineage for d6macc_ (6mac C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (3 PDB entries)

8. Domain d6macc_: 6mac C: [370617]
   Other proteins in same PDB: d6maca_
   automated match to d1s4yc_
   complexed with nag

Details for d6macc_

PDB Entry: 6mac, 2.34 Å

PDB Description: ternary structure of gdf11 bound to actriib-ecd and alk5-ecd

PDB Compounds: (C:) Activin receptor type-2B

SCOPe Domain Sequences for d6macc_:

Sequence; same for both SEQRES and ATOM records:

>d6macc_ g.7.1.3 (C:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
treciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncy
drqecvateenpqvyfcccegnfcnerfthlpepg

Timeline for d6macc_:

• d6macc_ first appeared in SCOPe 2.07