![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (7 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370420] (4 PDB entries) |
![]() | Domain d6jo5b_: 6jo5 B: [370607] Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5j_, d6jo5z_ automated match to d5l8rb_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo5 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jo5b_ f.29.1.1 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} hklfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiiflwt sgnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsgvy qwwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhlsg lfgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdtas hvfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgighrm qaileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppyafq aidfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkealish lswvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdfllssk tsaafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgalda rgsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhltl wqgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyatgf mfliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyifty aafliastsgrf
Timeline for d6jo5b_: