Lineage for d6jo5b_ (6jo5 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633152Species Chlamydomonas reinhardtii [TaxId:3055] [370420] (4 PDB entries)
  8. 2633159Domain d6jo5b_: 6jo5 B: [370607]
    Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5j_, d6jo5z_
    automated match to d5l8rb_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo5b_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (B:) photosystem I p700 chlorophyll a apoprotein a2

SCOPe Domain Sequences for d6jo5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo5b_ f.29.1.1 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
hklfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiiflwt
sgnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsgvy
qwwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhlsg
lfgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdtas
hvfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgighrm
qaileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppyafq
aidfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkealish
lswvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdfllssk
tsaafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgalda
rgsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhltl
wqgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyatgf
mfliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyifty
aafliastsgrf

SCOPe Domain Coordinates for d6jo5b_:

Click to download the PDB-style file with coordinates for d6jo5b_.
(The format of our PDB-style files is described here.)

Timeline for d6jo5b_: