Lineage for d1cpja_ (1cpj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926592Protein (Pro)cathepsin B [54022] (3 species)
  7. 2926608Species Norway rat (Rattus norvegicus) [TaxId:10116] [54024] (4 PDB entries)
  8. 2926613Domain d1cpja_: 1cpj A: [37060]

Details for d1cpja_

PDB Entry: 1cpj (more details), 2.2 Å

PDB Description: crystal structures of recombinant rat cathepsin b and a cathepsin b- inhibitor complex: implications for structure-based inhibitor design
PDB Compounds: (A:) cathepsin b

SCOPe Domain Sequences for d1cpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpja_ d.3.1.1 (A:) (Pro)cathepsin B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
gieseivagiprt

SCOPe Domain Coordinates for d1cpja_:

Click to download the PDB-style file with coordinates for d1cpja_.
(The format of our PDB-style files is described here.)

Timeline for d1cpja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cpjb_