![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein (Pro)cathepsin B [54022] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [54024] (4 PDB entries) |
![]() | Domain d1cpja_: 1cpj A: [37060] |
PDB Entry: 1cpj (more details), 2.2 Å
SCOPe Domain Sequences for d1cpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpja_ d.3.1.1 (A:) (Pro)cathepsin B {Norway rat (Rattus norvegicus) [TaxId: 10116]} lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc gieseivagiprt
Timeline for d1cpja_: