Lineage for d1theb_ (1the B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497141Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2497142Protein (Pro)cathepsin B [54022] (3 species)
  7. 2497158Species Norway rat (Rattus norvegicus) [TaxId:10116] [54024] (4 PDB entries)
  8. 2497160Domain d1theb_: 1the B: [37057]
    complexed with 0e6

Details for d1theb_

PDB Entry: 1the (more details), 1.9 Å

PDB Description: crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
PDB Compounds: (B:) cathepsin b

SCOPe Domain Sequences for d1theb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1theb_ d.3.1.1 (B:) (Pro)cathepsin B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
gieseivagiprt

SCOPe Domain Coordinates for d1theb_:

Click to download the PDB-style file with coordinates for d1theb_.
(The format of our PDB-style files is described here.)

Timeline for d1theb_: