Lineage for d2pbh__ (2pbh -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (16 proteins) 
Protein (Pro)cathepsin B [54022] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [54023] (5 PDB entries) 
Domain d2pbh__: 2pbh - [37055]
Details for d2pbh__
PDB Entry: 2pbh (more details), 3.3 Å
PDB Description: crystal structure of human procathepsin b at 3.3 angstrom resolution
SCOP Domain Sequences for d2pbh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbh__ d.3.1.1 (-) (Pro)cathepsin B {Human (Homo sapiens)}
mrsrpsfhplsdelvnyvnkrnttwqaghnfynvdmsylkrlcgtflggpkppqrvmfte
dlklpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnahvsvevsae
dlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrp
pctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvy
sdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgq
dhcgiesevvagiprtd
SCOP Domain Coordinates for d2pbh__:
Click to download the PDB-style file with coordinates for d2pbh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pbh__:
- d2pbh__ first appeared (with stable ids) in SCOP 1.55
- d2pbh__ appears in SCOP 1.59
- d2pbh__ appears in the current release, SCOPe 2.08, called d2pbha_
View in 3D