Lineage for d1pbh__ (1pbh -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (15 proteins) 
Protein (Pro)cathepsin B [54022] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [54023] (5 PDB entries) 
Domain d1pbh__: 1pbh - [37054]
Details for d1pbh__
PDB Entry: 1pbh (more details), 3.2 Å
PDB Description: crystal structure of human recombinant procathepsin b at 3.2 angstrom resolution
SCOP Domain Sequences for d1pbh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbh__ d.3.1.1 (-) (Pro)cathepsin B {Human (Homo sapiens)}
mrsrpsfhplsdelvnyvnkrnttwqaghnfynvdmsylkrlcgtflggpkppqrvmfte
dlklpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnahvsvevsae
dlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrp
pctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvy
sdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgq
dhcgiesevvagiprtd
SCOP Domain Coordinates for d1pbh__:
Click to download the PDB-style file with coordinates for d1pbh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pbh__:
- d1pbh__ appears in SCOP 1.57
- d1pbh__ appears in the current release, SCOPe 2.08, called d1pbha_
View in 3D