SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3pbha_ (3pbh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154580Protein (Pro)cathepsin B [54022] (3 species)
  7. 2154585Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries)
  8. 2154593Domain d3pbha_: 3pbh A: [37053]

Details for d3pbha_

PDB Entry: 3pbh (more details), 2.5 Å

PDB Description: refined crystal structure of human procathepsin b at 2.5 angstrom resolution
PDB Compounds: (A:) procathepsin b

SCOPe Domain Sequences for d3pbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pbha_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]}
mrsrpsfhplsdelvnyvnkrnttwqaghnfynvdmsylkrlcgtflggpkppqrvmfte
dlklpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnahvsvevsae
dlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrp
pctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvy
sdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgq
dhcgiesevvagiprtd

SCOPe Domain Coordinates for d3pbha_:

Click to download the PDB-style file with coordinates for d3pbha_.
(The format of our PDB-style files is described here.)

Timeline for d3pbha_: