Lineage for d6jo53_ (6jo5 3:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633684Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries)
  8. 2633708Domain d6jo53_: 6jo5 3: [370526]
    Other proteins in same PDB: d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5j_
    automated match to d4y283_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo53_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (3:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6jo53_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo53_ f.43.1.0 (3:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
lpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaagciapevlgaaglipda
tnikwfesgvippagsyngywadpytiffveivamqfaelrrlqdfrypgsmgqqyflgl
eaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrlamlamlgygaqavmtgk
gpfqnlvehladpvnnniltnf

SCOPe Domain Coordinates for d6jo53_:

Click to download the PDB-style file with coordinates for d6jo53_.
(The format of our PDB-style files is described here.)

Timeline for d6jo53_: