Lineage for d6jtda_ (6jtd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911315Species Trollius chinensis [TaxId:78479] [370410] (1 PDB entry)
  8. 2911316Domain d6jtda_: 6jtd A: [370520]
    automated match to d2vcha_
    complexed with edo, udp

Details for d6jtda_

PDB Entry: 6jtd (more details), 1.85 Å

PDB Description: crystal structure of tccgt1 in complex with udp
PDB Compounds: (A:) C-glycosyltransferase

SCOPe Domain Sequences for d6jtda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jtda_ c.87.1.0 (A:) automated matches {Trollius chinensis [TaxId: 78479]}
npnstskphvfllaspgmghlipflelskrlvtlntlqvtlfivsneatkarshlmessn
nfhpdlelvdltpanlsellstdatvfkriflitqaaikdlesrissmstppaalivdvf
smdafpvadrfgikkyvfvtlnawflalttyvrtldreiegeyvdlpepiaipgckplrp
edvfdpmlsrssdgyrpylgmserltkadglllntwealepvslkalreneklnqimtpp
lypvgpvarttvqevvgnecldwlskqptesvlyvalgsggiisykqmtelawglemsrq
rfiwvvrlptmekdgacrffsdvnvkgpleylpegfldrnkelgmvlpnwgpqdailahp
stggflshcgwnsslesivngvpviawplyaeqkmnatllteelgvavrpevlptkavvs
rdeiekmvrrvieskegkmkrnrarsvqsdalkaiekggssyntlievakefeknhk

SCOPe Domain Coordinates for d6jtda_:

Click to download the PDB-style file with coordinates for d6jtda_.
(The format of our PDB-style files is described here.)

Timeline for d6jtda_: