Lineage for d6kbrc_ (6kbr C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643121Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2643122Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2643240Family g.68.1.0: automated matches [254208] (1 protein)
    not a true family
  6. 2643241Protein automated matches [254463] (3 species)
    not a true protein
  7. 2643244Species Human (Homo sapiens) [TaxId:9606] [255304] (3 PDB entries)
  8. 2643245Domain d6kbrc_: 6kbr C: [370519]
    automated match to d2jxda_
    complexed with gol

Details for d6kbrc_

PDB Entry: 6kbr (more details), 2 Å

PDB Description: crystal structure of human klk4 and spink2 derived klk4 inhibitor complex
PDB Compounds: (C:) k41043

SCOPe Domain Sequences for d6kbrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kbrc_ g.68.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpncrrysihgcnrmyapvcgsdmstyanectlcmkiregghnikiikngpcgas

SCOPe Domain Coordinates for d6kbrc_:

Click to download the PDB-style file with coordinates for d6kbrc_.
(The format of our PDB-style files is described here.)

Timeline for d6kbrc_: