Lineage for d6k16a1 (6k16 A:37-236)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335934Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2335935Protein automated matches [226931] (11 species)
    not a true protein
  7. 2335970Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. 2335983Domain d6k16a1: 6k16 A:37-236 [370507]
    Other proteins in same PDB: d6k16a2
    automated match to d2onha1
    complexed with mg

Details for d6k16a1

PDB Entry: 6k16 (more details), 2.2 Å

PDB Description: crystal structure of sesquisabinene b synthase 1 from santalum album
PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6k16a1:

Sequence, based on SEQRES records: (download)

>d6k16a1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfe
temkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknel
cedvkgllnlyeasflgwegedildeartfstaqlknvekkisspnlakivhhaldlplh
wrairyearwfidiyedeed

Sequence, based on observed residues (ATOM records): (download)

>d6k16a1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfe
temkealanisydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknelced
vkgllnlyeasflgwegedildeartfstaqlknvekkisspnlakivhhaldlplhwra
iryearwfidiyedeed

SCOPe Domain Coordinates for d6k16a1:

Click to download the PDB-style file with coordinates for d6k16a1.
(The format of our PDB-style files is described here.)

Timeline for d6k16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6k16a2