SCOPe 2.07: Domain d6k16a1: 6k16 A:37-236

Lineage for d6k16a1 (6k16 A:37-236)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (11 species)
   not a true protein

7. Species Santalum album [TaxId:35974] [367258] (11 PDB entries)

8. Domain d6k16a1: 6k16 A:37-236 [370507]
   Other proteins in same PDB: d6k16a2
   automated match to d2onha1
   complexed with mg

Details for d6k16a1

PDB Entry: 6k16, 2.2 Å

PDB Description: crystal structure of sesquisabinene b synthase 1 from santalum album

PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6k16a1:

Sequence, based on SEQRES records:

>d6k16a1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfe
temkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknel
cedvkgllnlyeasflgwegedildeartfstaqlknvekkisspnlakivhhaldlplh
wrairyearwfidiyedeed

Sequence, based on observed residues (ATOM records):

>d6k16a1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfe
temkealanisydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknelced
vkgllnlyeasflgwegedildeartfstaqlknvekkisspnlakivhhaldlplhwra
iryearwfidiyedeed

Timeline for d6k16a1:

• d6k16a1 is new in SCOPe 2.07-stable
  
• d6k16a1 appears in the current release, SCOPe 2.08