Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [370481] (4 PDB entries) |
Domain d6jo6d_: 6jo6 D: [370500] Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6z_ automated match to d5l8rd_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo6 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jo6d_ d.187.1.1 (D:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} wtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnl lkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnm rrigqnvnpikvkfsgrmmspaei
Timeline for d6jo6d_: